PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010924706.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family BES1
Protein Properties Length: 339aa    MW: 36240.1 Da    PI: 8.5507
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010924706.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF8222044.3e-6331502148
          DUF822   2 gsgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpleeae.aagssasaspesslq 95 
                     +++r ptw+ErEnnkrRERrRRaiaakiy+GLR++Gn+klpk++DnneVlkALc+eAGw+ve+DGttyrkg+kp e+++  +g sas sp++s+q
  XP_010924706.1   3 SGTRLPTWRERENNKRRERRRRAIAAKIYTGLRMYGNFKLPKHCDNNEVLKALCNEAGWTVEEDGTTYRKGCKPVERMDvGVGGSASPSPCTSYQ 97 
                     689************************************************************************777626799*********** PP

          DUF822  96 sslkssalaspvesysaspksssfpspssldsislasaasllpvlsvlslvss 148
                      s+++s+ +sp +s+ +sp+ss +   ++ + ++ ++ +s +p+l++ls++ss
  XP_010924706.1  98 PSPRASYNHSPPSSSLPSPSSSYITNTNNNNANKGTDGNSHIPWLKNLSSASS 150
                     66666666666666666666666666666666666666**********98766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056876.1E-653146IPR008540BES1/BZR1 plant transcription factor, N-terminal
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MPSGTRLPTW RERENNKRRE RRRRAIAAKI YTGLRMYGNF KLPKHCDNNE VLKALCNEAG  60
WTVEEDGTTY RKGCKPVERM DVGVGGSASP SPCTSYQPSP RASYNHSPPS SSLPSPSSSY  120
ITNTNNNNAN KGTDGNSHIP WLKNLSSASS TSCLKPPNHH FYIHGGSISA PVTPPLSSPT  180
ARSPRVKADW DDPAAQPPWA GAHYTFLPSS TPPSPGRQVI PDAAWLAGLR LPSGGPSSPT  240
YSLVSSNPFG FCNEASAGAG SSRMWTPGQS GACSPVPGGH ADVRMCNGIS DEFAFGSSCN  300
GNLQSNGLVK PWEGERIHEE CASDELELTL GSSRTRADA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010924706.10.0PREDICTED: protein BZR1 homolog 3-like
SwissprotQ5Z9E51e-134BZR3_ORYSJ; Protein BZR1 homolog 3
TrEMBLA0A067GE961e-142A0A067GE96_CITSI; Uncharacterized protein
TrEMBLV4W9571e-142V4W957_9R
STRINGVIT_10s0003g01790.t011e-137(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP136638112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G78700.11e-105BES1/BZR1 homolog 4